PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn291121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 261aa    MW: 28651.7 Da    PI: 6.0262
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn291121genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.48.5e-0769125157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +r+R  ++++ ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +R++ +k
  Achn291121  69 KRPRDLLNPKAVKYMQSVFSIKDAISKKESREISALFGVTVTQVRDFFTSQRIRVRK 125
                 799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.55666126IPR001356Homeobox domain
SMARTSM003890.003568130IPR001356Homeobox domain
SuperFamilySSF466893.59E-768130IPR009057Homeodomain-like
CDDcd000861.53E-569125No hitNo description
Gene3DG3DSA:1.10.10.601.4E-669131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEVLKDNQLD LAVYESKPSF QGLLDSQQEL LHSQIDHLHN IVFTQCQLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQSVFSIK DAISKKESRE ISALFGVTVT QVRDFFTSQR  120
IRVRKFVRLS RDRALRSNAS KEALMNTDPS MPSGLVQDGV PMNTDPLMTS GLVQHGIPMN  180
TDPAMPTGLL QDVVPMNTDP TIPIYPVPLN CVGSSSSGGG PSCSTQEETL PGLDESDRHF  240
VDNIFSFMRK EETFSGQVLN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4504692e-37AM450469.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X023104.10, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011659347.16e-90PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLA0A0A0K9486e-90A0A0A0K948_CUCSA; Uncharacterized protein
TrEMBLA0A0D2P9244e-91A0A0D2P924_G
STRINGVIT_07s0104g01580.t015e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52402123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.22e-67HB-other family protein